Lineage for d4czpa1 (4czp A:2-365)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720347Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. 2720351Domain d4czpa1: 4czp A:2-365 [261770]
    Other proteins in same PDB: d4czpa2
    automated match to d1mnpa_
    complexed with ca, gol, hem, mn

Details for d4czpa1

PDB Entry: 4czp (more details), 1.9 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with manganese (anomalous data)
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czpa1 a.93.1.1 (A:2-365) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
vcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgpsagg
gadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncpgap
rvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiaradkv
dptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdtglm
rlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvpvpk
pavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfsgpa
tdsp

SCOPe Domain Coordinates for d4czpa1:

Click to download the PDB-style file with coordinates for d4czpa1.
(The format of our PDB-style files is described here.)

Timeline for d4czpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czpa2