SCOPe 2.08: Domain d4czra1: 4czr A:2-364

Lineage for d4czra1 (4czr A:2-364)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)

8. Domain d4czra1: 4czr A:2-364 [261769]
   Other proteins in same PDB: d4czra2
   automated match to d1mnpa_
   complexed with ca, cd, gol, hem

Details for d4czra1

PDB Entry: 4czr, 1.98 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora in complex with cadmium (anomalous data)

PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czra1:

Sequence; same for both SEQRES and ATOM records:

>d4czra1 a.93.1.1 (A:2-364) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
vcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgpsagg
gadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncpgap
rvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiaradkv
dptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdtglm
rlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvpvpk
pavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfsgpa
tds

Timeline for d4czra1:

• d4czra1 first appeared in SCOPe 2.04, called d4czra_
  
• d4czra1 was called d4czra_ in SCOPe 2.07