Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein automated matches [190089] (9 species) not a true protein |
Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries) |
Domain d4czra1: 4czr A:2-364 [261769] Other proteins in same PDB: d4czra2 automated match to d1mnpa_ complexed with ca, cd, gol, hem |
PDB Entry: 4czr (more details), 1.98 Å
SCOPe Domain Sequences for d4czra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4czra1 a.93.1.1 (A:2-364) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]} vcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgpsagg gadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncpgap rvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiaradkv dptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdtglm rlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvpvpk pavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfsgpa tds
Timeline for d4czra1: