Lineage for d4czra_ (4czr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002776Protein automated matches [190089] (8 species)
    not a true protein
  7. 2002809Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. 2002814Domain d4czra_: 4czr A: [261769]
    automated match to d1mnpa_
    complexed with ca, cd, gol, hem

Details for d4czra_

PDB Entry: 4czr (more details), 1.98 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora in complex with cadmium (anomalous data)
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czra_ a.93.1.1 (A:) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
ptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgps
agggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncp
gaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiara
dkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdt
glmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvp
vpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfs
gpatds

SCOPe Domain Coordinates for d4czra_:

Click to download the PDB-style file with coordinates for d4czra_.
(The format of our PDB-style files is described here.)

Timeline for d4czra_: