SCOPe 2.04: Domain d4cpub_: 4cpu B:

Lineage for d4cpub_ (4cpu B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)

8. Domain d4cpub_: 4cpu B: [261766]
   automated match to d2xyfa_
   complexed with cl, v78

Details for d4cpub_

PDB Entry: 4cpu, 1.82 Å

PDB Description: macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4cpub_:

Sequence; same for both SEQRES and ATOM records:

>d4cpub_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d4cpub_:

• d4cpub_ is new in SCOPe 2.04-stable
  
• d4cpub_ appears in SCOPe 2.05
  
• d4cpub_ appears in the current release, SCOPe 2.08