SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4cpqa_ (4cpq A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2060049Protein automated matches [190433] (11 species)
    not a true protein
  7. 2060148Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)
  8. 2060172Domain d4cpqa_: 4cpq A: [261765]
    automated match to d2xyfa_
    complexed with 9mw, cl

Details for d4cpqa_

PDB Entry: 4cpq (more details), 2.35 Å

PDB Description: Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4cpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpqa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d4cpqa_:

Click to download the PDB-style file with coordinates for d4cpqa_.
(The format of our PDB-style files is described here.)

Timeline for d4cpqa_: