Lineage for d4cpra_ (4cpr A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392433Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)
  8. 2392445Domain d4cpra_: 4cpr A: [261761]
    automated match to d2xyfa_
    complexed with 378, cl

Details for d4cpra_

PDB Entry: 4cpr (more details), 1.8 Å

PDB Description: macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4cpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpra_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d4cpra_:

Click to download the PDB-style file with coordinates for d4cpra_.
(The format of our PDB-style files is described here.)

Timeline for d4cpra_: