Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (11 species) not a true protein |
Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries) |
Domain d4cpwa_: 4cpw A: [261758] automated match to d2xyfa_ complexed with cl, v78 |
PDB Entry: 4cpw (more details), 1.7 Å
SCOPe Domain Sequences for d4cpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cpwa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptptnvigrnlltqigctlnf
Timeline for d4cpwa_: