Lineage for d4cpwa_ (4cpw A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1549384Protein automated matches [190433] (11 species)
    not a true protein
  7. 1549461Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)
  8. 1549466Domain d4cpwa_: 4cpw A: [261758]
    automated match to d2xyfa_
    complexed with cl, v78

Details for d4cpwa_

PDB Entry: 4cpw (more details), 1.7 Å

PDB Description: macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4cpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpwa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d4cpwa_:

Click to download the PDB-style file with coordinates for d4cpwa_.
(The format of our PDB-style files is described here.)

Timeline for d4cpwa_: