SCOPe 2.08: Domain d4by4b_: 4by4 B:

Lineage for d4by4b_ (4by4 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (6 PDB entries)

8. Domain d4by4b_: 4by4 B: [261750]
   automated match to d2lcpa_
   complexed with ca, na

Details for d4by4b_

PDB Entry: 4by4, 2.3 Å

PDB Description: Crystal structure of Drosophila Frq2

PDB Compounds: (B:) fi18190p1

SCOPe Domain Sequences for d4by4b_:

Sequence, based on SEQRES records:

>d4by4b_ a.39.1.5 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
nsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskf
aslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyni
vdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqals

Sequence, based on observed residues (ATOM records):

>d4by4b_ a.39.1.5 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
nsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskf
aslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyni
vdaiyqmvgqkrvdkifdqmdknhddrltleefregskadprmvqals

Timeline for d4by4b_:

• d4by4b_ first appeared in SCOPe 2.04
  
• d4by4b_ appears in SCOPe 2.07