Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries) Uniprot Q8DQ00 2-127,330-357 |
Domain d4r5hb1: 4r5h B:2-127,B:330-358 [261741] Other proteins in same PDB: d4r5ha2, d4r5hb2 automated match to d2gyya1 complexed with 3jn, edo, na, nap |
PDB Entry: 4r5h (more details), 1.8 Å
SCOPe Domain Sequences for d4r5hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5hb1 c.2.1.3 (B:2-127,B:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng iiacpnXaawnsvqiaetlherglvrptaelkfelk
Timeline for d4r5hb1: