![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries) |
![]() | Domain d4wbnb2: 4wbn B:246-438 [261733] Other proteins in same PDB: d4wbna1, d4wbnb1, d4wbnc1, d4wbnd1, d4wbne_, d4wbnf1, d4wbnf2, d4wbnf3 automated match to d3rycd2 complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 4wbn (more details), 2.3 Å
SCOPe Domain Sequences for d4wbnb2:
Sequence, based on SEQRES records: (download)
>d4wbnb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d4wbnb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsraltvpeltqqmfdsknmmaacdprhgr yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
Timeline for d4wbnb2: