| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) |
| Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) |
| Domain d4v2ga2: 4v2g A:68-208 [261727] Other proteins in same PDB: d4v2ga1, d4v2ga3, d4v2gb1, d4v2gb3 automated match to d1bjza2 complexed with ctc, itc, mg |
PDB Entry: 4v2g (more details), 2.71 Å
SCOPe Domain Sequences for d4v2ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2ga2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Timeline for d4v2ga2: