Lineage for d4v2rb_ (4v2r B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010509Species Taxus wallichiana [TaxId:29808] [189805] (9 PDB entries)
  8. 2010541Domain d4v2rb_: 4v2r B: [261719]
    automated match to d1w27a_

Details for d4v2rb_

PDB Entry: 4v2r (more details), 2.2 Å

PDB Description: ironing out their differences: dissecting the structural determinants of a phenylalanine aminomutase and ammonia lyase
PDB Compounds: (B:) phenylalanine aminomutase (l-beta-phenylalanine forming)

SCOPe Domain Sequences for d4v2rb_:

Sequence, based on SEQRES records: (download)

>d4v2rb_ a.127.1.0 (B:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqrkaedgadiygvttgfgacssrrtnrgselqeslircllagvftkgcapsvdelpata
trsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayiagl
ligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatavastvmydan
vllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqelsrey
ysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandralhg
anfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdyglkg
ldiamaaysselqylanpvtthvhsaeqhnqdinslalisarkteealdilklmiashlt
amcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcdpt
lplllglkqscfdtilalhkkdgietdtlvdrlaefekrlsdrlenemtavrvlyekkgh
ktadnndalvriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvfdaiadgritvp
llhclqgfl

Sequence, based on observed residues (ATOM records): (download)

>d4v2rb_ a.127.1.0 (B:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqlqeslircllagvftdelpatatrsamllrlnsftygcsgirwevmealekllnsnvs
pkvplrgsvsasgdliplayiaglligkpsviarigevpapealsrvglrpfklqakegl
alvngtsfatavastvmydanvllllvetlcgmfcevifgreefahplihkvkphpgqie
saellewllrsspfqelsreyysidkkpkqdryalrsspqwlaplvqtirdatttvetev
nsandnpiidhandralhganfqgsavgfymdyvriavaglgkllfaqftelmieyysng
lpgnlslgpdlsvdyglkgldiamaaysselqylanpvtthvhsaeqhnqdinslalisa
rkteealdilklmiashltamcqavdlrqleealvkvvenvvstladecglpndtkarll
yvakavpvytylespcdptlplllglkqscfdtilalhtdtlvdrlaefekrlsdrlene
mtavrvlyekkgtadnndalvriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvf
daiadgritvpllhclqgfl

SCOPe Domain Coordinates for d4v2rb_:

Click to download the PDB-style file with coordinates for d4v2rb_.
(The format of our PDB-style files is described here.)

Timeline for d4v2rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4v2ra_