Lineage for d4u30w_ (4u30 W:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637558Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2637559Protein automated matches [190829] (13 species)
    not a true protein
  7. 2637594Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)
  8. 2637603Domain d4u30w_: 4u30 W: [261714]
    Other proteins in same PDB: d4u30a_, d4u30b_, d4u30c_, d4u30d_
    automated match to d3bybb_
    complexed with ca

Details for d4u30w_

PDB Entry: 4u30 (more details), 2.5 Å

PDB Description: Human mesotrypsin complexed with bikunin Kunitz domain 2
PDB Compounds: (W:) Trypstatin

SCOPe Domain Sequences for d4u30w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u30w_ g.8.1.0 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg

SCOPe Domain Coordinates for d4u30w_:

Click to download the PDB-style file with coordinates for d4u30w_.
(The format of our PDB-style files is described here.)

Timeline for d4u30w_: