SCOPe 2.08: Domain d4u30y_: 4u30 Y:

Lineage for d4u30y_ (4u30 Y:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)

8. Domain d4u30y_: 4u30 Y: [261713]
   Other proteins in same PDB: d4u30a_, d4u30b_, d4u30c_, d4u30d_
   automated match to d3bybb_
   complexed with ca

Details for d4u30y_

PDB Entry: 4u30, 2.5 Å

PDB Description: Human mesotrypsin complexed with bikunin Kunitz domain 2

PDB Compounds: (Y:) Trypstatin

SCOPe Domain Sequences for d4u30y_:

Sequence; same for both SEQRES and ATOM records:

>d4u30y_ g.8.1.0 (Y:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg

Timeline for d4u30y_:

• d4u30y_ first appeared in SCOPe 2.04
  
• d4u30y_ appears in SCOPe 2.07