Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries) |
Domain d4u30y_: 4u30 Y: [261713] Other proteins in same PDB: d4u30a_, d4u30b_, d4u30c_, d4u30d_ automated match to d3bybb_ complexed with ca |
PDB Entry: 4u30 (more details), 2.5 Å
SCOPe Domain Sequences for d4u30y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u30y_ g.8.1.0 (Y:) automated matches {Human (Homo sapiens) [TaxId: 9606]} acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg
Timeline for d4u30y_: