Lineage for d4u2na2 (4u2n A:128-248)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189641Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2189642Protein automated matches [190710] (3 species)
    not a true protein
  7. 2189643Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)
  8. 2189706Domain d4u2na2: 4u2n A:128-248 [261712]
    Other proteins in same PDB: d4u2na3, d4u2nb3
    automated match to d3ga1b_

Details for d4u2na2

PDB Entry: 4u2n (more details), 2.3 Å

PDB Description: Crystal structure of a complex of the Miz1- and Nac1 POZ domains.
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 17,Nucleus accumbens-associated protein 1

SCOPe Domain Sequences for d4u2na2:

Sequence, based on SEQRES records: (download)

>d4u2na2 d.42.1.0 (A:128-248) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnn
srsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimekgteffl
k

Sequence, based on observed residues (ATOM records): (download)

>d4u2na2 d.42.1.0 (A:128-248) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnn
srsavvelpaavqpqsfqqilsfcytgrlsdqdllmytagflqiqeimekgtefflk

SCOPe Domain Coordinates for d4u2na2:

Click to download the PDB-style file with coordinates for d4u2na2.
(The format of our PDB-style files is described here.)

Timeline for d4u2na2: