| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
| Protein automated matches [190710] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries) |
| Domain d4u2na1: 4u2n A:2-105 [261709] Other proteins in same PDB: d4u2na3, d4u2nb3 automated match to d3ga1b_ |
PDB Entry: 4u2n (more details), 2.3 Å
SCOPe Domain Sequences for d4u2na1:
Sequence, based on SEQRES records: (download)
>d4u2na1 d.42.1.0 (A:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdii
>d4u2na1 d.42.1.0 (A:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdkdvvhl
disnaaglgqvlefmytaklslspenvddvlavatflqmqdii
Timeline for d4u2na1: