Lineage for d4u2nb1 (4u2n B:2-105)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552682Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. 2552752Domain d4u2nb1: 4u2n B:2-105 [261708]
    Other proteins in same PDB: d4u2na3, d4u2nb3
    automated match to d3ga1b_

Details for d4u2nb1

PDB Entry: 4u2n (more details), 2.3 Å

PDB Description: Crystal structure of a complex of the Miz1- and Nac1 POZ domains.
PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 17,Nucleus accumbens-associated protein 1

SCOPe Domain Sequences for d4u2nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u2nb1 d.42.1.0 (B:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdii

SCOPe Domain Coordinates for d4u2nb1:

Click to download the PDB-style file with coordinates for d4u2nb1.
(The format of our PDB-style files is described here.)

Timeline for d4u2nb1: