SCOPe 2.08: Domain d4u2nb1: 4u2n B:2-105

Lineage for d4u2nb1 (4u2n B:2-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d4u2nb1: 4u2n B:2-105 [261708]
   Other proteins in same PDB: d4u2na3, d4u2nb3
   automated match to d3ga1b_

Details for d4u2nb1

PDB Entry: 4u2n, 2.3 Å

PDB Description: Crystal structure of a complex of the Miz1- and Nac1 POZ domains.

PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 17,Nucleus accumbens-associated protein 1

SCOPe Domain Sequences for d4u2nb1:

Sequence; same for both SEQRES and ATOM records:

>d4u2nb1 d.42.1.0 (B:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdii

Timeline for d4u2nb1:

• d4u2nb1 first appeared in SCOPe 2.04
  
• d4u2nb1 appears in SCOPe 2.07