Lineage for d4u2fa_ (4u2f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869719Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins)
    automatically mapped to Pfam PF01738
  6. 1869725Protein automated matches [190856] (2 species)
    not a true protein
  7. 1869736Species Pseudomonas sp. [TaxId:65741] [258104] (7 PDB entries)
  8. 1869741Domain d4u2fa_: 4u2f A: [261707]
    automated match to d1zi6a_
    complexed with so4

Details for d4u2fa_

PDB Entry: 4u2f (more details), 1.8 Å

PDB Description: crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution
PDB Compounds: (A:) Carboxymethylenebutenolidase

SCOPe Domain Sequences for d4u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u2fa_ c.69.1.9 (A:) automated matches {Pseudomonas sp. [TaxId: 65741]}
mltegisiqsydghtfgalvgspakapapviviaheilgvnafmretvswlvdqgyaavc
pdlharqapgtaldpqdeaqreqayklwqafdmeagvgdleaairyarhlpysngkvglv
gyslggalaflvaakgcvdravgycgvglekqldkvpevkhpalfhmggqdhfvpapsrq
litegfganpllqvhwyegaghsfartgssdyvasaaalanertldflaplqs

SCOPe Domain Coordinates for d4u2fa_:

Click to download the PDB-style file with coordinates for d4u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d4u2fa_: