Lineage for d4tw8b1 (4tw8 B:21-140)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644294Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1644393Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 1644394Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 1644420Domain d4tw8b1: 4tw8 B:21-140 [261705]
    automated match to d1q1ca1
    complexed with 37m

Details for d4tw8b1

PDB Entry: 4tw8 (more details), 3 Å

PDB Description: The Fk1-Fk2 domains of FKBP52 in complex with iFit-FL
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4tw8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tw8b1 d.26.1.1 (B:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge

SCOPe Domain Coordinates for d4tw8b1:

Click to download the PDB-style file with coordinates for d4tw8b1.
(The format of our PDB-style files is described here.)

Timeline for d4tw8b1: