SCOPe 2.08: Domain d4rvra1: 4rvr A:1858-1972

Lineage for d4rvra1 (4rvr A:1858-1972)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d4rvra1: 4rvr A:1858-1972 [261696]
   Other proteins in same PDB: d4rvra2
   automated match to d4ir5a_
   complexed with 3wq, edo

Details for d4rvra1

PDB Entry: 4rvr, 1.98 Å

PDB Description: crystal structure of the bromodomain of human baz2b in complex with gsk2801

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4rvra1:

Sequence; same for both SEQRES and ATOM records:

>d4rvra1 a.29.2.0 (A:1858-1972) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs

Timeline for d4rvra1:

• d4rvra1 first appeared in SCOPe 2.04, called d4rvra_
  
• d4rvra1 appears in SCOPe 2.07