SCOPe 2.07: Domain d1bmm.1: 1bmm L:,H:

Lineage for d1bmm.1 (1bmm L:,H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1bmm.1: 1bmm L:,H: [26169]
   complexed with bm2

Details for d1bmm.1

PDB Entry: 1bmm, 2.6 Å

PDB Description: human alpha-thrombin complexed with [s-(r*,r*)]-4-[(aminoiminomethyl)amino]-n-[[1-[3-hydroxy-2-[(2-naphthalenylsulfonyl)amino]-1-oxopropyl]-2-pyrrolidinyl] methyl]butanamide (bms-186282)

PDB Compounds: (H:) alpha-thrombin, (L:) alpha-thrombin

SCOPe Domain Sequences for d1bmm.1:

Sequence; same for both SEQRES and ATOM records:

>g1bmm.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyXivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Timeline for d1bmm.1:

• d1bmm.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bmm.1 appears in SCOPe 2.06
  
• d1bmm.1 appears in the current release, SCOPe 2.08