SCOPe 2.05: Domain d4qrra2: 4qrr A:182-276

Lineage for d4qrra2 (4qrr A:182-276)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4qrra2: 4qrr A:182-276 [261680]
   Other proteins in same PDB: d4qrra1, d4qrrb_
   automated match to d1a9ea1

Details for d4qrra2

PDB Entry: 4qrr, 3 Å

PDB Description: crystal structure of hla b*3501-ips in complex with a delta-beta tcr, clone 12 tcr

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d4qrra2:

Sequence; same for both SEQRES and ATOM records:

>d4qrra2 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d4qrra2:

• d4qrra2 first appeared in SCOPe 2.04
  
• d4qrra2 appears in SCOPe 2.06
  
• d4qrra2 appears in the current release, SCOPe 2.08