Lineage for d4r54b2 (4r54 B:128-329)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659010Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1659017Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1659048Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 1659076Domain d4r54b2: 4r54 B:128-329 [261677]
    Other proteins in same PDB: d4r54a1, d4r54b1
    automated match to d2gyya2
    complexed with 3jm, act, na, nap

Details for d4r54b2

PDB Entry: 4r54 (more details), 1.81 Å

PDB Description: complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4r54b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r54b2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d4r54b2:

Click to download the PDB-style file with coordinates for d4r54b2.
(The format of our PDB-style files is described here.)

Timeline for d4r54b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r54b1