SCOP 1.71: Domain d1dwc.1: 1dwc L:,H:

Lineage for d1dwc.1 (1dwc L:,H:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (157 PDB entries)

8. Domain d1dwc.1: 1dwc L:,H: [26167]
   complexed with mit

Details for d1dwc.1

PDB Entry: 1dwc, 3 Å

PDB Description: crystallographic analysis at 3.0-angstroms resolution of the binding to human thrombin of four active site-directed inhibitors

SCOP Domain Sequences for d1dwc.1:

Sequence; same for both SEQRES and ATOM records:

>g1dwc.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Timeline for d1dwc.1:

• d1dwc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1dwc.1 appears in SCOP 1.69
  
• d1dwc.1 appears in SCOP 1.73
  
• d1dwc.1 appears in the current release, SCOPe 2.08