SCOPe 2.08: Domain d1dwc.1: 1dwc L:,H:

Lineage for d1dwc.1 (1dwc L:,H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1dwc.1: 1dwc L:,H: [26167]
   complexed with mit

Details for d1dwc.1

PDB Entry: 1dwc, 3 Å

PDB Description: crystallographic analysis at 3.0-angstroms resolution of the binding to human thrombin of four active site-directed inhibitors

PDB Compounds: (H:) alpha-thrombin (large subunit), (L:) alpha-thrombin (small subunit)

SCOPe Domain Sequences for d1dwc.1:

Sequence; same for both SEQRES and ATOM records:

>g1dwc.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Timeline for d1dwc.1:

• d1dwc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1dwc.1 appears in SCOPe 2.07