SCOPe 2.06: Domain d4r4ja1: 4r4j A:2-127,A:330-358

Lineage for d4r4ja1 (4r4j A:2-127,A:330-358)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
   Uniprot Q8DQ00 2-127,330-357

8. Domain d4r4ja1: 4r4j A:2-127,A:330-358 [261669]
   Other proteins in same PDB: d4r4ja2, d4r4ja3, d4r4jb2
   automated match to d2gyya1
   complexed with 3jl, edo, na, nap

Details for d4r4ja1

PDB Entry: 4r4j, 1.51 Å

PDB Description: crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate

PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4r4ja1:

Sequence; same for both SEQRES and ATOM records:

>d4r4ja1 c.2.1.3 (A:2-127,A:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelk

Timeline for d4r4ja1:

• d4r4ja1 first appeared in SCOPe 2.04
  
• d4r4ja1 appears in SCOPe 2.05
  
• d4r4ja1 appears in SCOPe 2.07
  
• d4r4ja1 appears in the current release, SCOPe 2.08