Lineage for d4r3wb2 (4r3w B:128-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203135Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 2203166Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 2203194Domain d4r3wb2: 4r3w B:128-329 [261668]
    Other proteins in same PDB: d4r3wa1, d4r3wb1
    automated match to d2gyya2
    complexed with 3gq, a2p, act, edo, na

Details for d4r3wb2

PDB Entry: 4r3w (more details), 1.91 Å

PDB Description: crystal structure analysis of the 1,2,3-tricarboxylate benzoic acid bound to sp-asadh-2'5'-adp complex
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4r3wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r3wb2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d4r3wb2:

Click to download the PDB-style file with coordinates for d4r3wb2.
(The format of our PDB-style files is described here.)

Timeline for d4r3wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r3wb1