Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries) |
Domain d4omla1: 4oml A:85-140 [261662] Other proteins in same PDB: d4omla2 automated match to d4cc4b_ complexed with peg, pge; mutant |
PDB Entry: 4oml (more details), 1.6 Å
SCOPe Domain Sequences for d4omla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omla1 b.34.2.0 (A:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
Timeline for d4omla1: