Lineage for d4nrib_ (4nri B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164354Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2164391Domain d4nrib_: 4nri B: [261661]
    Other proteins in same PDB: d4nria_
    automated match to d3tgda_
    complexed with gol; mutant

Details for d4nrib_

PDB Entry: 4nri (more details), 2.3 Å

PDB Description: Crystal Structure of a human Mms2/Ubc13 A122G mutant
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4nrib_:

Sequence, based on SEQRES records: (download)

>d4nrib_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplg
ndvaeqwktneaqaietarawtrlyamn

Sequence, based on observed residues (ATOM records): (download)

>d4nrib_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdgndv
aeqwktneaqaietarawtrlyamn

SCOPe Domain Coordinates for d4nrib_:

Click to download the PDB-style file with coordinates for d4nrib_.
(The format of our PDB-style files is described here.)

Timeline for d4nrib_: