SCOPe 2.05: Domain d4wz8b1: 4wz8 B:1480-1814

Lineage for d4wz8b1 (4wz8 B:1480-1814)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries)

8. Domain d4wz8b1: 4wz8 B:1480-1814 [261637]
   automated match to d1uyta1
   complexed with 3w7

Details for d4wz8b1

PDB Entry: 4wz8, 2.23 Å

PDB Description: crystal structure of human-yeast chimera acetyl coa carboxylase ct domain bound to compound 6

PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d4wz8b1:

Sequence; same for both SEQRES and ATOM records:

>d4wz8b1 c.14.1.4 (B:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

Timeline for d4wz8b1:

• d4wz8b1 first appeared in SCOPe 2.04
  
• d4wz8b1 appears in SCOPe 2.06
  
• d4wz8b1 appears in the current release, SCOPe 2.08