Lineage for d4wz8c1 (4wz8 C:1494-1814)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1584983Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1585145Protein automated matches [226926] (3 species)
    not a true protein
  7. 1585171Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (5 PDB entries)
  8. 1585174Domain d4wz8c1: 4wz8 C:1494-1814 [261635]
    automated match to d1uyta1
    complexed with 3w7

Details for d4wz8c1

PDB Entry: 4wz8 (more details), 2.23 Å

PDB Description: crystal structure of human-yeast chimera acetyl coa carboxylase ct domain bound to compound 6
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d4wz8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wz8c1 c.14.1.4 (C:1494-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengeltev
erepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteyark
rgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdken
svltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcrsv
gigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlggtqimynngvshlta
vddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d4wz8c1:

Click to download the PDB-style file with coordinates for d4wz8c1.
(The format of our PDB-style files is described here.)

Timeline for d4wz8c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wz8c2