Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries) |
Domain d4wkea_: 4wke A: [261634] automated match to d3ljta_ complexed with 3pu, ca, edo, zn |
PDB Entry: 4wke (more details), 1.62 Å
SCOPe Domain Sequences for d4wkea_:
Sequence, based on SEQRES records: (download)
>d4wkea_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsg eegpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadv gtvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvmapvm ahvdpeepwspcsarfitdfldngyghclldkpeaplhlp
>d4wkea_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilegp qvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvc dparscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpe epwspcsarfitdfldngyghclldkpeaplhlp
Timeline for d4wkea_: