Lineage for d4wk7a_ (4wk7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2964911Domain d4wk7a_: 4wk7 A: [261633]
    automated match to d3ljta_
    complexed with 3pq, ca, zn

Details for d4wk7a_

PDB Entry: 4wk7 (more details), 1.24 Å

PDB Description: crystal structure of human adamts-4 in complex with inhibitor (compound 1, 2-(4-chlorophenoxy)-n-{[(4r)-4-methyl-2,5- dioxoimidazolidin-4-yl]methyl} acetamide)
PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 4

SCOPe Domain Sequences for d4wk7a_:

Sequence, based on SEQRES records: (download)

>d4wk7a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsge
egpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvg
tvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvmapvma
hvdpeepwspcsarfitdfldngyghclldkpeapl

Sequence, based on observed residues (ATOM records): (download)

>d4wk7a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgpqv
gpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvcdp
arscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpeep
wspcsarfitdfldngyghclldkpeapl

SCOPe Domain Coordinates for d4wk7a_:

Click to download the PDB-style file with coordinates for d4wk7a_.
(The format of our PDB-style files is described here.)

Timeline for d4wk7a_: