Lineage for d4w9pa_ (4w9p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941584Protein automated matches [191209] (6 species)
    not a true protein
  7. 2941590Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)
  8. 2941635Domain d4w9pa_: 4w9p A: [261624]
    Other proteins in same PDB: d4w9pe2
    automated match to d3o5qa_
    complexed with 3jr, act

Details for d4w9pa_

PDB Entry: 4w9p (more details), 1.5 Å

PDB Description: The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1S)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4w9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9pa_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrnepfv
fslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeielldfk
g

SCOPe Domain Coordinates for d4w9pa_:

Click to download the PDB-style file with coordinates for d4w9pa_.
(The format of our PDB-style files is described here.)

Timeline for d4w9pa_: