SCOPe 2.04: Domain d3vfja_: 3vfj A:

Lineage for d3vfja_ (3vfj A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein automated matches [190140] (17 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (13 PDB entries)

8. Domain d3vfja_: 3vfj A: [261621]
   automated match to d3ruma_
   complexed with act, cac, gcs, man, nag, t55, zn

Details for d3vfja_

PDB Entry: 3vfj, 2.05 Å

PDB Description: the structure of monodechloro-teicoplanin in complex with its ligand, using mbp as a ligand carrier

PDB Compounds: (A:) Maltose-binding periplasmic protein, C-terminal fused by Cys-Lys-D-Ala-D-Ala

SCOPe Domain Sequences for d3vfja_:

Sequence; same for both SEQRES and ATOM records:

>d3vfja_ c.94.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnaaaaagckaa

Timeline for d3vfja_:

• d3vfja_ is new in SCOPe 2.04-stable
  
• d3vfja_ appears in SCOPe 2.05
  
• d3vfja_ appears in the current release, SCOPe 2.08