Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins) |
Protein automated matches [190140] (17 species) not a true protein |
Domain d3vfja_: 3vfj A: [261621] automated match to d3ruma_ complexed with act, cac, gcs, man, nag, t55, zn |
PDB Entry: 3vfj (more details), 2.05 Å
SCOPe Domain Sequences for d3vfja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vfja_ c.94.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtnaaaaagckaa
Timeline for d3vfja_: