Lineage for d4v2fa2 (4v2f A:68-208)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1746971Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1746972Species Escherichia coli [TaxId:562] [48501] (23 PDB entries)
  8. 1746998Domain d4v2fa2: 4v2f A:68-208 [261620]
    Other proteins in same PDB: d4v2fa1
    automated match to d1bjza2

Details for d4v2fa2

PDB Entry: 4v2f (more details), 2.4 Å

PDB Description: tetracycline repressor tetr(d), unliganded
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4v2fa2:

Sequence, based on SEQRES records: (download)

>d4v2fa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d4v2fa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehlppllrealqimdsddgeqaflhgleslirgfevql
tallqiv

SCOPe Domain Coordinates for d4v2fa2:

Click to download the PDB-style file with coordinates for d4v2fa2.
(The format of our PDB-style files is described here.)

Timeline for d4v2fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v2fa1