SCOPe 2.06: Domain d4v2fa1: 4v2f A:3-67

Lineage for d4v2fa1 (4v2f A:3-67)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)

8. Domain d4v2fa1: 4v2f A:3-67 [261619]
   Other proteins in same PDB: d4v2fa2, d4v2fa3
   automated match to d1bjza1

Details for d4v2fa1

PDB Entry: 4v2f, 2.4 Å

PDB Description: tetracycline repressor tetr(d), unliganded

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4v2fa1:

Sequence; same for both SEQRES and ATOM records:

>d4v2fa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

Timeline for d4v2fa1:

• d4v2fa1 first appeared in SCOPe 2.04
  
• d4v2fa1 appears in SCOPe 2.05
  
• d4v2fa1 appears in SCOPe 2.07
  
• d4v2fa1 appears in the current release, SCOPe 2.08