Lineage for d4v2fa1 (4v2f A:2-67)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477968Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1478159Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 1478160Species Escherichia coli [TaxId:562] [46766] (26 PDB entries)
  8. 1478190Domain d4v2fa1: 4v2f A:2-67 [261619]
    Other proteins in same PDB: d4v2fa2
    automated match to d1bjza1

Details for d4v2fa1

PDB Entry: 4v2f (more details), 2.4 Å

PDB Description: tetracycline repressor tetr(d), unliganded
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4v2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v2fa1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOPe Domain Coordinates for d4v2fa1:

Click to download the PDB-style file with coordinates for d4v2fa1.
(The format of our PDB-style files is described here.)

Timeline for d4v2fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v2fa2