Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries) |
Domain d4u30b_: 4u30 B: [261615] Other proteins in same PDB: d4u30w_, d4u30x_, d4u30y_, d4u30z_ automated match to d3p95a_ complexed with ca |
PDB Entry: 4u30 (more details), 2.5 Å
SCOPe Domain Sequences for d4u30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u30b_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]} ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d4u30b_: