| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein Trypsin(ogen) [50515] (9 species) |
| Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries) |
| Domain d4u30a_: 4u30 A: [261614] Other proteins in same PDB: d4u30w_, d4u30x_, d4u30y_, d4u30z_ automated match to d3p95a_ complexed with ca |
PDB Entry: 4u30 (more details), 2.5 Å
SCOPe Domain Sequences for d4u30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u30a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d4u30a_: