SCOPe 2.08: Domain d3sqpb3: 3sqp B:364-478

Lineage for d3sqpb3 (3sqp B:364-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Glutathione reductase [55426] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)

8. Domain d3sqpb3: 3sqp B:364-478 [261601]
   Other proteins in same PDB: d3sqpa1, d3sqpa2, d3sqpb1, d3sqpb2
   automated match to d3grsa3
   protein/RNA complex; complexed with 3j8, fad, gol, so4

Details for d3sqpb3

PDB Entry: 3sqp, 2.21 Å

PDB Description: Structure of human glutathione reductase complexed with pyocyanin, an agent with antimalarial activity

PDB Compounds: (B:) glutathione reductase, mitochondrial

SCOPe Domain Sequences for d3sqpb3:

Sequence; same for both SEQRES and ATOM records:

>d3sqpb3 d.87.1.1 (B:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

Timeline for d3sqpb3:

• d3sqpb3 first appeared in SCOPe 2.04
  
• d3sqpb3 appears in SCOPe 2.07