Lineage for d4tkla_ (4tkl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095950Species Sphingomonas sp. [TaxId:90322] [189409] (6 PDB entries)
  8. 2095957Domain d4tkla_: 4tkl A: [261597]
    automated match to d3rihc_
    complexed with po4

Details for d4tkla_

PDB Entry: 4tkl (more details), 1.8 Å

PDB Description: Crystal structure of NADH-dependent reductase A1-R' responsible for alginate metabolism
PDB Compounds: (A:) NADH-dependent reductase for 4-deoxy-L-erythro-5-hexoseulose uronate

SCOPe Domain Sequences for d4tkla_:

Sequence, based on SEQRES records: (download)

>d4tkla_ c.2.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
fsdlkgkrilitgstegigmataielarygavvglnshvdpadpalllgklreaggdgaf
fraditktaecqrlvsafverfdgidvlinnagglagrsnleniddafydrvmdlngrsv
lmmtkfaiphlrasakasgttsavistgsiaaregggigagvyaaskawlhdihrnwvke
ftkdsirfnivapgtvdtafhadksdelktriansipmgrfgtvqelapayvffashaas
gyitgqildvnggqicp

Sequence, based on observed residues (ATOM records): (download)

>d4tkla_ c.2.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
fsdlkgkrilitgstegigmataielarygavvglnshvdpadpalllgklreaggdgaf
fraditktaecqrlvsafverfdgidvlinnagglagrsnleniddafydrvmdlngrsv
lmmtkfaiphlrasakasgttsavistgsiaaregggigagvyaaskawlhdihrnwvke
ftkdsirfnivapgtvdktriansipmgrfgtvqelapayvffashaasgyitgqildvn
ggqicp

SCOPe Domain Coordinates for d4tkla_:

Click to download the PDB-style file with coordinates for d4tkla_.
(The format of our PDB-style files is described here.)

Timeline for d4tkla_: