Lineage for d4rv5a_ (4rv5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913265Species Anabaena variabilis [TaxId:240292] [256373] (9 PDB entries)
  8. 2913272Domain d4rv5a_: 4rv5 A: [261596]
    automated match to d4nqrb_
    complexed with fmt, mg, pyr

Details for d4rv5a_

PDB Entry: 4rv5 (more details), 1.04 Å

PDB Description: the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
PDB Compounds: (A:) Amino acid/amide ABC transporter substrate-binding protein, HAAT family

SCOPe Domain Sequences for d4rv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rv5a_ c.93.1.0 (A:) automated matches {Anabaena variabilis [TaxId: 240292]}
ntipigialaqtsnvallgqeqvagakiaekyfndkggvngtpiklifqdtagdeagtin
afqtlinkdkvvgivgptlsqqafsanpiaerakvpvvgpsntakgipeigdyvarvsap
vsvvapnsvkaalkqnpnikkvavffaqndafskseteifqqtvkdqglelvtvqkfqtt
dtdfqsqatnainlkpdlviisglaadggnlvrqlrelgyqgaiiggnglntsnvfavck
alcdgvliaqayspeytgeinkafrqayvdqykkeppqfsaqafaavqvyveslkaldtk
nkvskiqlpelrtelnkqlltgkyntplgeisftpigevvqkdfyvaqikmekdgsqgkf
tflk

SCOPe Domain Coordinates for d4rv5a_:

Click to download the PDB-style file with coordinates for d4rv5a_.
(The format of our PDB-style files is described here.)

Timeline for d4rv5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4rv5b_