Lineage for d4rkfa_ (4rkf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849838Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (7 PDB entries)
  8. 1849839Domain d4rkfa_: 4rkf A: [261577]
    automated match to d3l0ib_
    complexed with 1pe, gnp, mg

Details for d4rkfa_

PDB Entry: 4rkf (more details), 1.5 Å

PDB Description: Drosophila melanogaster Rab3 bound to GMPPNP
PDB Compounds: (A:) Ras-related protein Rab-3

SCOPe Domain Sequences for d4rkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkfa_ c.37.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qnfdymfklliignssvgktsflfryaddsftsafvstvgidfkvktvfrhdkrvklqiw
dtagleryrtittayyrgamgfilmydvtnedsfnsvqdwvtqiktyswdnaqvilvgnk
cdmedqrvisfergrqladqlgveffetsakenvnvkavferlvdiicdkm

SCOPe Domain Coordinates for d4rkfa_:

Click to download the PDB-style file with coordinates for d4rkfa_.
(The format of our PDB-style files is described here.)

Timeline for d4rkfa_: