Lineage for d4rjed_ (4rje D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080513Species Aerococcus viridans [TaxId:1377] [187639] (8 PDB entries)
  8. 2080529Domain d4rjed_: 4rje D: [261575]
    automated match to d2du2a_
    complexed with edo, fnr, pyr; mutant

Details for d4rjed_

PDB Entry: 4rje (more details), 1.65 Å

PDB Description: aerococcus viridans l-lactate oxidase mutant
PDB Compounds: (D:) Lactate oxidase

SCOPe Domain Sequences for d4rjed_:

Sequence, based on SEQRES records: (download)

>d4rjed_ c.1.4.0 (D:) automated matches {Aerococcus viridans [TaxId: 1377]}
ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
aqdveapdtsteilghkikapfimapigahglahatkeagtaravsefgtimsisaysga
tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
kfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe
dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
npygyey

Sequence, based on observed residues (ATOM records): (download)

>d4rjed_ c.1.4.0 (D:) automated matches {Aerococcus viridans [TaxId: 1377]}
ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
aqdveapdtsteilghkikapfimapigahglahatkeagtaravsefgtimsisaysga
tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
kfvypfgmpivqryltaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpeda
dmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakal
asgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnp
ygyey

SCOPe Domain Coordinates for d4rjed_:

Click to download the PDB-style file with coordinates for d4rjed_.
(The format of our PDB-style files is described here.)

Timeline for d4rjed_: