Lineage for d1dx5.3 (1dx5 C:,O:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 562018Protein Thrombin [50531] (2 species)
  7. 562065Species Human (Homo sapiens) [TaxId:9606] [50532] (157 PDB entries)
  8. 562175Domain d1dx5.3: 1dx5 C:,O: [26157]
    Other proteins in same PDB: d1dx5i1, d1dx5i2, d1dx5i3, d1dx5j1, d1dx5j2, d1dx5j3, d1dx5k1, d1dx5k2, d1dx5k3, d1dx5l1, d1dx5l2, d1dx5l3

Details for d1dx5.3

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex

SCOP Domain Sequences for d1dx5.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dx5.3 b.47.1.2 (C:,O:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1dx5.3:

Click to download the PDB-style file with coordinates for d1dx5.3.
(The format of our PDB-style files is described here.)

Timeline for d1dx5.3: