Lineage for d4qrre2 (4qrr E:129-256)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034036Domain d4qrre2: 4qrr E:129-256 [261565]
    Other proteins in same PDB: d4qrra1, d4qrrb_
    automated match to d2axhb2

Details for d4qrre2

PDB Entry: 4qrr (more details), 3 Å

PDB Description: crystal structure of hla b*3501-ips in complex with a delta-beta tcr, clone 12 tcr
PDB Compounds: (E:) clone12 TCR alpha chain

SCOPe Domain Sequences for d4qrre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qrre2 b.1.1.0 (E:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4qrre2:

Click to download the PDB-style file with coordinates for d4qrre2.
(The format of our PDB-style files is described here.)

Timeline for d4qrre2: