Lineage for d4r3wa1 (4r3w A:2-127,A:330-358)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843586Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 2843617Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 2843652Domain d4r3wa1: 4r3w A:2-127,A:330-358 [261557]
    Other proteins in same PDB: d4r3wa2, d4r3wb2
    automated match to d2gyya1
    complexed with 3gq, a2p, act, edo, na

Details for d4r3wa1

PDB Entry: 4r3w (more details), 1.91 Å

PDB Description: crystal structure analysis of the 1,2,3-tricarboxylate benzoic acid bound to sp-asadh-2'5'-adp complex
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4r3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r3wa1 c.2.1.3 (A:2-127,A:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelk

SCOPe Domain Coordinates for d4r3wa1:

Click to download the PDB-style file with coordinates for d4r3wa1.
(The format of our PDB-style files is described here.)

Timeline for d4r3wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r3wa2