Lineage for d4qgeb_ (4qge B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015146Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 2015147Species Chimpanzee (Pan troglodytes) [TaxId:9598] [261550] (1 PDB entry)
  8. 2015149Domain d4qgeb_: 4qge B: [261555]
    automated match to d2hd1a_
    complexed with 35o, mg, zn

Details for d4qgeb_

PDB Entry: 4qge (more details), 2 Å

PDB Description: phosphodiesterase-9A in complex with inhibitor WYQ-C36D
PDB Compounds: (B:) Phosphodiesterase 9A

SCOPe Domain Sequences for d4qgeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgeb_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
esrdryeelkriddamkelq

SCOPe Domain Coordinates for d4qgeb_:

Click to download the PDB-style file with coordinates for d4qgeb_.
(The format of our PDB-style files is described here.)

Timeline for d4qgeb_: