SCOPe 2.06: Domain d4quna1: 4qun A:628-908

Lineage for d4quna1 (4qun A:628-908)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (117 PDB entries)

8. Domain d4quna1: 4qun A:628-908 [261551]
   Other proteins in same PDB: d4quna2, d4qunb2
   automated match to d2cfva_
   complexed with gol, po4; mutant

Details for d4quna1

PDB Entry: 4qun, 1.86 Å

PDB Description: Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 3

SCOPe Domain Sequences for d4quna1:

Sequence; same for both SEQRES and ATOM records:

>d4quna1 c.45.1.0 (A:628-908) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtlegsmaqlkkglesgtvliqfeqlyrkkpglaitfaklpqnldknrykdvlpydttrv
llqgnedyinasyvnmeipaanlvnkyiatqgplphtcaqfwqvvwdqklslivmlttlt
ergrtkchqywpdppdvmnhggfhiqcqsedctiayvsremlvtntqtgeehtvthlqyv
awpdhgvpddssdflefvnyvrslrvdsepvlvhssagigrtgvlvtmetamclternlp
iypldivrkmrdqrammvqtssqykfvceailrvyeeglvq

Timeline for d4quna1:

• d4quna1 first appeared in SCOPe 2.04, called d4quna_
  
• d4quna1 was called d4quna_ in SCOPe 2.05
  
• d4quna1 appears in SCOPe 2.07
  
• d4quna1 appears in the current release, SCOPe 2.08